| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AP1S1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AP1S1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP1S1. This antibody reacts with human. The AP1S1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AP1S1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKSVLKAIEQADLLQEEDESPRSVLEEMGLA |
|---|
| Other Names | adaptor-related protein complex 1, sigma 1 subunit, AP19HA1 19 kDa subunit, CLAPS1FLJ92436, Clathrin assembly protein complex 1 sigma-1A small chain, Clathrin coat assembly protein AP19, Golgi adaptor HA1/AP1 adaptin sigma-1A subunit, Sigma 1a subunit of AP-1 clathrin, SIGMA1A, sigma1A subunit of AP-1 clathrin adaptor complex, Sigma1A-adaptin, Sigma-adaptin 1A, small 1 (19kD) |
|---|
| Gene, Accession # | AP1S1, Gene ID: 1174, Accession: P61966 |
|---|
| Catalog # | NBP2-46862 |
|---|
| Price | |
|---|
| Order / More Info | AP1S1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|