| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AP1S3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AP1S3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP1S3. This antibody reacts with human. The AP1S3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AP1S3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRY |
|---|
| Other Names | Adapter-Related Protein Complex 1 Subunit Sigma-1C, Adaptor Protein Complex AP-1 Sigma-1C Subunit, Adaptor Protein Complex AP-1 Subunit Sigma-1C, Adaptor-Related Protein Complex 1 Subunit Sigma-1C, Adaptor-Related Protein Complex 1, Sigma 3 Subunit, Clathrin Assembly Protein Complex 1 Sigma-1C Small Chain, Golgi Adaptor HA1/AP1 Adaptin Sigma-1C Subunit, PSORS15, Sigma 1C Subunit Of AP-1 Clathrin, Sigma1C-Adaptin |
|---|
| Gene, Accession # | AP1S3, Gene ID: 130340 |
|---|
| Catalog # | NBP2-49493 |
|---|
| Price | |
|---|
| Order / More Info | AP1S3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|