| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AP3S1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AP3S1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP3S1. This antibody reacts with human. The AP3S1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE. |
|---|
| Other Names | Adapter-related protein complex 3 sigma-1 subunit, adaptor-related protein complex 3, sigma 1 subunit, AP-3 complex sigma-3A subunit, AP-3 complex subunit sigma-3A, CLAPS3AP-3 complex subunit sigma-1, Clathrin-associated/assembly/adapter protein, small 3, clathrin-associated/assembly/adaptor protein, small 3 (22kD), Sigma3A, sigma-3A-adaptin, Sigma3A-adaptin, Sigma-adaptin 3a |
|---|
| Gene, Accession # | AP3S1, Gene ID: 1176, Accession: Q92572, SwissProt: Q92572 |
|---|
| Catalog # | NBP1-55449 |
|---|
| Price | |
|---|
| Order / More Info | AP3S1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 15469849 |
|---|
| 产品资料 |
|
|