| Edit |   |
|---|
| Antigenic Specificity | BAI2 |
|---|
| Clone | 6A12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG3 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BAI2 Antibody (6A12) from Novus Biologicals is a mouse monoclonal antibody to BAI2. This antibody reacts with human. The BAI2 Antibody (6A12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | BAI2 (NP_001694, 22 a.a. - 108 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ |
|---|
| Other Names | brain-specific angiogenesis inhibitor 2, Brain-specific angiongenesis inhibitor-2 |
|---|
| Gene, Accession # | BAI2, Gene ID: 576, Accession: NP_001694, SwissProt: NP_001694 |
|---|
| Catalog # | H00000576-M01 |
|---|
| Price | |
|---|
| Order / More Info | BAI2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|