| Edit |   |
| Antigenic Specificity | CACHD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CACHD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CACHD1. This antibody reacts with human. The CACHD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CACHD1(cache domain containing 1) The peptide sequence was selected from the N terminal of CACHD1. Peptide sequence HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA. |
| Other Names | cache domain containing 1, Cache domain-containing protein 1, KIAA1573VWFA and cache domain-containing protein 1, RP4-655E10.1, von Willebrand factor type A and cache domain containing 1, VWCD1 |
| Gene, Accession # | CACHD1, Gene ID: 57685, Accession: Q5VU97, SwissProt: Q5VU97 |
| Catalog # | NBP1-59989 |
| Price | |
| Order / More Info | CACHD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |