| Edit |   |
|---|
| Antigenic Specificity | MPPE1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MPPE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MPPE1. This antibody reacts with human. The MPPE1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MPPE1(metallophosphoesterase 1) The peptide sequence was selected from the N terminal of MPPE1. Peptide sequence WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG. |
|---|
| Other Names | EC 3.1, metallo phosphoesterase, metallophosphoesterase 1, PGAP5, Post-GPI attachment to proteins factor 5 |
|---|
| Gene, Accession # | MPPE1, Gene ID: 65258, Accession: Q53F39, SwissProt: Q53F39 |
|---|
| Catalog # | NBP1-69305 |
|---|
| Price | |
|---|
| Order / More Info | MPPE1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|