| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OCTN1/SLC22A4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OCTN1/SLC22A4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OCTN1/SLC22A4. This antibody reacts with human. The OCTN1/SLC22A4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SLGMTLPETLEQMQKVKWFRSGKKTRDSMETEENPKVLITAF |
|---|
| Other Names | Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H |
|---|
| Gene, Accession # | SLC22A4, Gene ID: 6583 |
|---|
| Catalog # | NBP2-68632 |
|---|
| Price | |
|---|
| Order / More Info | OCTN1/SLC22A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|