| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OCTN1/SLC22A4 |
|---|
| Clone | 2D3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. WB usage reported from customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OCTN1/SLC22A4 Antibody (2D3) from Novus Biologicals is a mouse monoclonal antibody to OCTN1/SLC22A4. This antibody reacts with human, rat. The OCTN1/SLC22A4 Antibody (2D3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SLC22A4 (NP_003050, 43 a.a. - 141 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK |
|---|
| Other Names | Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H |
|---|
| Gene, Accession # | SLC22A4, Gene ID: 6583, Accession: NP_003050, SwissProt: NP_003050 |
|---|
| Catalog # | H00006583-M01 |
|---|
| Price | |
|---|
| Order / More Info | OCTN1/SLC22A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|