| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OCTN2/SLC22A5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OCTN2/SLC22A5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OCTN2/SLC22A5. This antibody reacts with human. The OCTN2/SLC22A5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human OCTN2/SLC22A5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWN |
|---|
| Other Names | CDSP, FLJ46769, High-affinity sodium-dependent carnitine cotransporter, OCTN2high-affinity sodium dependent carnitine cotransporter, OCTN2VT, organic cation transporter 2, organic cation transporter 5, Organic cation/carnitine transporter 2, SCD, solute carrier family 22 (organic cation transporter), member 5, solute carrier family 22 (organic cation/carnitine transporter), member 5, solute carrier family 22 member 5 |
|---|
| Gene, Accession # | SLC22A5, Gene ID: 6584 |
|---|
| Catalog # | NBP2-57222 |
|---|
| Price | |
|---|
| Order / More Info | OCTN2/SLC22A5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|