| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RIN2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RIN2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RIN2. This antibody reacts with human. The RIN2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RIN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GEMTAWTMGARGLDKRGSFFKLIDTIASEIGELKQEMVRTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCAR |
|---|
| Other Names | RAB5 interacting protein 2, Ras and Rab interactor 2, RAS association (RalGDS/AF-6) domain containing protein JC265, Ras association domain family 4, Ras inhibitor JC265, Ras interaction/interference protein 2, RASSF4MACS |
|---|
| Gene, Accession # | RIN2, Gene ID: 54453 |
|---|
| Catalog # | NBP1-80854 |
|---|
| Price | |
|---|
| Order / More Info | RIN2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22825554, 23435261 |
|---|
| 产品资料 |
|
|