| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PGL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PGL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGL2. This antibody reacts with human. The PGL2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PGL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FAKEHLQHMTEKQLNLYDRLINEPSNDWDIYYWATEAKPAPEIFENEVMALLRDFAKNKNKEQRLRAPDLEYLFE |
|---|
| Other Names | C11orf79, FLJ20487, hSDH5, paraganglioma or familial glomus tumors 2, PGL2chromosome 11 open reading frame 79, SDH5SDH assembly factor 2, succinate dehydrogenase assembly factor 2, mitochondrial, succinate dehydrogenase complex assembly factor 2, Succinate dehydrogenase subunit 5, mitochondrial |
|---|
| Gene, Accession # | SDHAF2, Gene ID: 54949 |
|---|
| Catalog # | NBP1-92259 |
|---|
| Price | |
|---|
| Order / More Info | PGL2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|