| 产品详情 |
| Edit |   |
| Antigenic Specificity | DPP10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DPP10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPP10. This antibody reacts with human. The DPP10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DPP10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHSTDN PAKYFILESNSMLKEAILKKK |
| Other Names | dipeptidyl peptidase 10, Dipeptidyl peptidase IV-related protein 3, dipeptidyl peptidase like protein 2, Dipeptidyl peptidase X, Dipeptidyl peptidase-like protein 2, dipeptidyl-peptidase 10, dipeptidyl-peptidase 10 (non-functional), DPL2, DPP X, DPPY, DPRP-3, DPRP3dipeptidylpeptidase 10, inactive dipeptidyl peptidase 10, KIAA1492 |
| Gene, Accession # | DPP10, Gene ID: 57628 |
| Catalog # | NBP2-13936 |
| Price | |
| Order / More Info | DPP10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|