| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WFDC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ELISA, WB reported in scientific literature (PMID: 24934811). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WFDC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WFDC1. This antibody reacts with human, mouse. The WFDC1 Antibody has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human WFDC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ |
|---|
| Other Names | ps20 growth inhibitor, PS20Prostate stromal protein ps20, WAP four-disulfide core domain 1, WAP four-disulfide core domain 1 homolog, WAP four-disulfide core domain protein 1 |
|---|
| Gene, Accession # | WFDC1, Gene ID: 58189 |
|---|
| Catalog # | NBP1-87207 |
|---|
| Price | |
|---|
| Order / More Info | WFDC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24934811 |
|---|
| 产品资料 |
|
|