| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBE2G2 |
|---|
| Clone | 5E1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBE2G2 Antibody (5E1) from Novus Biologicals is a mouse monoclonal antibody to UBE2G2. This antibody reacts with human. The UBE2G2 Antibody (5E1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | UBE2G2 (NP_003329, 1 a.a. - 87 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR |
|---|
| Other Names | EC 6.3.2.19, UBC7human ubiquitin conjugating enzyme G210ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7), Ubiquitin carrier protein G2, ubiquitin conjugating enzyme 7, ubiquitin conjugating enzyme G2, ubiquitin-conjugating enzyme E2 G2, ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast), Ubiquitin-protein ligase G2 |
|---|
| Gene, Accession # | UBE2G2, Gene ID: 7327, Accession: NP_003334.2, SwissProt: NP_003334.2 |
|---|
| Catalog # | H00007327-M01 |
|---|
| Price | |
|---|
| Order / More Info | UBE2G2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22081612 |
|---|
| 产品资料 |
|
|