| Edit |   |
| Antigenic Specificity | Fibrinogen gamma chain |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Fibrinogen gamma chain Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fibrinogen gamma chain. This antibody reacts with human. The Fibrinogen gamma chain Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to FGG(fibrinogen gamma chain) The peptide sequence was selected from the middle region of Fibrinogen gamma chain. Peptide sequence GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ. |
| Other Names | fibrinogen gamma chain, fibrinogen, gamma polypeptide |
| Gene, Accession # | FGG, Gene ID: 2266 |
| Catalog # | NBP1-69291 |
| Price | |
| Order / More Info | Fibrinogen gamma chain Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |