| Edit |   |
| Antigenic Specificity | RBPMS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RBPMS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBPMS2. This antibody reacts with human. The RBPMS2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RBPMS2(RNA binding protein with multiple splicing 2) The peptide sequence was selected from the middle region of RBPMS2. Peptide sequence MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW. |
| Other Names | RNA binding protein with multiple splicing 2, RNA-binding protein with multiple splicing 2 |
| Gene, Accession # | RBPMS2, Gene ID: 348093, Accession: Q6ZRY4, SwissProt: Q6ZRY4 |
| Catalog # | NBP1-57399-20ul |
| Price | |
| Order / More Info | RBPMS2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |