| Edit |   |
|---|
| Antigenic Specificity | RBPMS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBPMS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBPMS2. This antibody reacts with human. The RBPMS2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RBPMS2(RNA binding protein with multiple splicing 2) The peptide sequence was selected from the middle region of RBPMS2. Peptide sequence MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW. |
|---|
| Other Names | RNA binding protein with multiple splicing 2, RNA-binding protein with multiple splicing 2 |
|---|
| Gene, Accession # | RBPMS2, Gene ID: 348093, Accession: Q6ZRY4, SwissProt: Q6ZRY4 |
|---|
| Catalog # | NBP1-57399 |
|---|
| Price | |
|---|
| Order / More Info | RBPMS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|