| 产品详情 |
| Edit |   |
| Antigenic Specificity | Adenylate Cyclase 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Adenylate Cyclase 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Adenylate Cyclase 2. This antibody reacts with human. The Adenylate Cyclase 2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Adenylate Cyclase 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATA |
| Other Names | 3'-5'-cyclic AMP synthetase, AC2, adenylate cyclase 2 (brain), adenylate cyclase II, adenylate cyclase type 2, Adenylate cyclase type II, Adenylyl cyclase 2, ATP pyrophosphate-lyase 2, EC 4.6.1.1, FLJ45092, HBAC2, KIAA1060FLJ16822, MGC133314, type II adenylate cyclase |
| Gene, Accession # | ADCY2, Gene ID: 108 |
| Catalog # | NBP1-90281 |
| Price | |
| Order / More Info | Adenylate Cyclase 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|