| 产品详情 |
| Edit |   |
| Antigenic Specificity | CBFB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CBFB Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBFB. This antibody reacts with human. The CBFB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CBFB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKV |
| Other Names | CBF-beta, core-binding factor subunit beta, core-binding factor, beta subunit, PEA2-beta, PEBP2B, PEBP2-beta, polyomavirus enhancer binding protein 2, beta subunit, Polyomavirus enhancer-binding protein 2 beta subunit, SL3/AKV core-binding factor beta subunit, SL3-3 enhancer factor 1 beta subunit, SL3-3 enhancer factor 1 subunit beta |
| Gene, Accession # | CBFB, Gene ID: 865 |
| Catalog # | NBP1-87300 |
| Price | |
| Order / More Info | CBFB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|