| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CBF1-interacting corepressor |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CBF1-interacting corepressor Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBF1-interacting corepressor. This antibody reacts with human. The CBF1-interacting corepressor Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD |
|---|
| Other Names | CBF1 interacting corepressor, CBF1-interacting corepressor, CIRrecepin, corepressor interacting with RBPJ 1, corepressor interacting with RBPJ, 1, Recepin |
|---|
| Gene, Accession # | CIR1, Gene ID: 9541 |
|---|
| Catalog # | NBP2-68775 |
|---|
| Price | |
|---|
| Order / More Info | CBF1-interacting corepressor Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|