| Edit |   |
| Antigenic Specificity | RNF222 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RNF222 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF222. This antibody reacts with human. The RNF222 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RNF222 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQV QRTLVCPICRYVTFLSKKSSRWPSMLDKSSQTLAVP |
| Other Names | RNF222 ring finger protein 222 |
| Gene, Accession # | RNF222, Gene ID: 643904 |
| Catalog # | NBP2-14664 |
| Price | |
| Order / More Info | RNF222 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |