| Edit |   |
|---|
| Antigenic Specificity | RNF23 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF23 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF23. This antibody reacts with human. The RNF23 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RNF23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDATQEYKE |
|---|
| Other Names | MGC32984, RING finger protein 23RNF23TFPtripartite motif-containing 39, Testis-abundant finger protein, TRIM39B, tripartite motif containing 39, tripartite motif-containing protein 39 |
|---|
| Gene, Accession # | TRIM39, Gene ID: 56658, Accession: Q9HCM9, SwissProt: Q9HCM9 |
|---|
| Catalog # | NBP2-33605 |
|---|
| Price | |
|---|
| Order / More Info | RNF23 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|