| Edit |   |
|---|
| Antigenic Specificity | REEP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The REEP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to REEP1. This antibody reacts with human. The REEP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to REEP1(receptor accessory protein 1) The peptide sequence was selected from the middle region of REEP1. Peptide sequence AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI. |
|---|
| Other Names | C2orf23, chromosome 2 open reading frame 23, receptor accessory protein 1, receptor expression-enhancing protein 1, SPG31FLJ13110 |
|---|
| Gene, Accession # | REEP1, Gene ID: 65055, Accession: Q9H902, SwissProt: Q9H902 |
|---|
| Catalog # | NBP1-62374 |
|---|
| Price | |
|---|
| Order / More Info | REEP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|