| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | REEP5 |
|---|
| Clone | 3G11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The REEP5 Antibody (3G11) from Novus Biologicals is a mouse monoclonal antibody to REEP5. This antibody reacts with human. The REEP5 Antibody (3G11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | C5orf18 (NP_005660 113 a.a. - 184 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS |
|---|
| Other Names | C5orf18polyposis coli region hypothetical protein DP1, chromosome 5 open reading frame 18, D5S346deleted in polyposis 1, DP1TB2YOP1, MGC70440, Polyposis locus protein 1, Protein TB2, receptor accessory protein 5, receptor expression enhancing protein 5, receptor expression-enhancing protein 5 |
|---|
| Gene, Accession # | REEP5, Gene ID: 7905, Accession: NP_005660, SwissProt: NP_005660 |
|---|
| Catalog # | H00007905-M04 |
|---|
| Price | |
|---|
| Order / More Info | REEP5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|