| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HLA C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.05 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HLA C Antibody from Novus Biologicals is a mouse polyclonal antibody to HLA C. This antibody reacts with human. The HLA C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | HLA-C (AAH02463, 1 a.a. - 366 a.a.) full-length human protein. MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA |
|---|
| Other Names | C alpha chain, D6S204, FLJ27082, HLA class I histocompatibility antigen, Cw-1 alpha chain, HLAC, HLA-Cw, HLA-JY3, HLC-C, human leukocyte antigen-C alpha chain, leucocyte antigen C, leucocyte antigen Cw, leukocyte antigen-C alpha chain, major histocompatibility antigen HLA-C, major histocompatibility complex, class I, C, MHC class I antigen Cw*1, MHC class I antigen Cw*12, MHC class I antigen Cw*14, MHC class I antigen Cw*15, MHC class I antigen Cw*16, MHC class I antigen Cw*17, MHC class I antigen Cw*2, MHC class I antigen Cw*3, MHC class I antigen Cw*4, MHC class I antigen Cw*5, MHC class I antigen Cw*6, MHC class I antigen Cw*7, MHC class I antigen Cw*8, MHC class I antigen heavy chain HLA-C, PSORS1 |
|---|
| Gene, Accession # | HLA-C, Gene ID: 3107, Accession: AAH02463, SwissProt: AAH02463 |
|---|
| Catalog # | H00003107-B01P |
|---|
| Price | |
|---|
| Order / More Info | HLA C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|