| Edit |   |
| Antigenic Specificity | DERA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DERA Antibody from Novus Biologicals is a rabbit polyclonal antibody to DERA. This antibody reacts with human. The DERA Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human DERA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVAS |
| Other Names | deoxyriboaldolase, deoxyribose-phosphate aldolase (putative), phosphodeoxyriboaldolase |
| Gene, Accession # | DERA, Gene ID: 51071 |
| Catalog # | NBP2-58642 |
| Price | |
| Order / More Info | DERA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |