| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BAZ2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BAZ2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to BAZ2A. This antibody reacts with human. The BAZ2A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human BAZ2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLEVPLTASVTSPKASPVTSPAAAFPTASPANKDVSSFLETTADVEEITGEGLTASGSGDVMRRRIATPEEVRLPLQHGWRREVRIKKGSHR |
|---|
| Other Names | bromodomain adjacent to zinc finger domain protein 2A, bromodomain adjacent to zinc finger domain, 2A, DKFZp781B109, FLJ45876, hWALp3, KIAA0314FLJ13768, Tip5, TIP5FLJ13780, Transcription termination factor I-interacting protein 5, TTF-I interacting peptide 5, TTF-I-interacting protein 5, WALp3 |
|---|
| Gene, Accession # | BAZ2A, Gene ID: 11176 |
|---|
| Catalog # | NBP2-55854 |
|---|
| Price | |
|---|
| Order / More Info | BAZ2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|