| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 4-1BB Ligand/TNFSF9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 4-1BB Ligand/TNFSF9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 4-1BB Ligand/TNFSF9. This antibody reacts with human. The 4-1BB Ligand/TNFSF9 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human 4-1BB Ligand/TNFSF9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL |
|---|
| Other Names | 4-1BB ligand, 4-1BBL, 4-1BB-L, CD137L, homolog of mouse 4-1BB-L, receptor 4-1BB ligand, tumor necrosis factor (ligand) superfamily, member 9, tumor necrosis factor ligand superfamily member 9 |
|---|
| Gene, Accession # | TNFSF9, Gene ID: 8744 |
|---|
| Catalog # | NBP2-56103 |
|---|
| Price | |
|---|
| Order / More Info | 4-1BB Ligand/TNFSF9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|