| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kv1.1 |
|---|
| Clone | 2D8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kv1.1 Antibody (2D8) from Novus Biologicals is a mouse monoclonal antibody to Kv1.1. This antibody reacts with human. The Kv1.1 Antibody (2D8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | KCNA1 (NP_000208.1 410 a.a. - 495 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV |
|---|
| Other Names | AEMK, EA1, HBK1, HUK1, Kv1.1, MBK1, MGC126782, MGC138385, MK1, potassium voltage-gated channel subfamily A member 1, potassium voltage-gated channel, shaker-related subfamily, member 1 (episodicataxia with myokymia), RBK1, Voltage-gated K(+) channel HuKI, Voltage-gated potassium channel HBK1, Voltage-gated potassium channel subunit Kv1.1 |
|---|
| Gene, Accession # | KCNA1, Gene ID: 3736, Accession: NP_000208, SwissProt: NP_000208 |
|---|
| Catalog # | H00003736-M05 |
|---|
| Price | |
|---|
| Order / More Info | Kv1.1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|