| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kv1.3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kv1.3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kv1.3. This antibody reacts with human. The Kv1.3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kv1 |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIK |
|---|
| Other Names | HGK5, HLK3KV1.3, HPCN3PCN3, HUKIII, Kv1.3, MK3, potassium channel 3, potassium voltage-gated channel subfamily A member 3, potassium voltage-gated channel, shaker-related subfamily, member 3, type n potassium channel, Voltage-gated K(+) channel HuKIII, voltage-gated potassium channel protein Kv1.3, Voltage-gated potassium channel subunit Kv1.3 |
|---|
| Gene, Accession # | KCNA3, Gene ID: 3738 |
|---|
| Catalog # | NBP2-48533 |
|---|
| Price | |
|---|
| Order / More Info | Kv1.3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|