| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kv1.4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kv1.4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kv1.4. This antibody reacts with human. The Kv1.4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kv1 |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV |
|---|
| Other Names | cardiac potassium channel, fetal skeletal muscle potassium channel, HBK4, HK1, HPCN2HUKII, KCNA4L, KCNA8, Kv1.4, PCN2, potassium channel 2, potassium voltage-gated channel subfamily A member 4, potassium voltage-gated channel, shaker-related subfamily, member 4, potassium voltage-gated channel, shaker-related subfamily, member 4-like, rapidly inactivating potassium channel, shaker-related potassium channel Kv1.4, type A potassium channel, Voltage-gated K(+) channel HuKII, Voltage-gated potassium channel HBK4, Voltage-gated potassium channel HK1, Voltage-gated potassium channel subunit Kv1.4 |
|---|
| Gene, Accession # | KCNA4, Gene ID: 3739 |
|---|
| Catalog # | NBP1-89691 |
|---|
| Price | |
|---|
| Order / More Info | Kv1.4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|