| 产品详情 |
| Edit |   |
| Antigenic Specificity | DNAJB6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DNAJB6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAJB6. This antibody reacts with human. The DNAJB6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DNAJB6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLK |
| Other Names | DJ4, DKFZp566D0824, DnaJ, DnaJ (Hsp40) homolog, subfamily B, member 6, dnaJ homolog subfamily B member 6, DnaJ-like 2 protein, FLJ42837, Heat shock protein J2, HHDJ1, HSJ2, HSJ-2, MGC1152, MRJMGC117297, MSJ1, MSJ-1 |
| Gene, Accession # | DNAJB6, Gene ID: 10049 |
| Catalog # | NBP2-49286 |
| Price | |
| Order / More Info | DNAJB6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|