| Edit |   |
|---|
| Antigenic Specificity | DNAJC13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNAJC13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAJC13. This antibody reacts with human. The DNAJC13 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DNAJC13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VTPGGFDQINPATNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFASEQREEIIKSAIDHAGNYIGISLRIRKEPLEFEQYLNLRF |
|---|
| Other Names | DnaJ (Hsp40) homolog, subfamily C, member 13, DnaJ domain-containing protein RME-8, dnaJ homolog subfamily C member 13, required for receptor-mediated endocytosis 8 |
|---|
| Gene, Accession # | DNAJC13, Gene ID: 23317 |
|---|
| Catalog # | NBP1-93623 |
|---|
| Price | |
|---|
| Order / More Info | DNAJC13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|