| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAK10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAK10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAK10. This antibody reacts with human. The MAK10 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human MAK10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVL |
|---|
| Other Names | bA379P1.1, corneal wound healing-related protein, EGAP, embryonic growth-associated protein homolog, FLJ21613, FLJ22643, MAK10, MAK10 homolog, amino-acid N-acetyltransferase subunit, N(alpha)-acetyltransferase 35, NatC auxiliary subunit, N-alpha-acetyltransferase 35, NatC auxiliary subunit, protein MAK10 homolog |
|---|
| Gene, Accession # | NAA35, Gene ID: 60560 |
|---|
| Catalog # | NBP2-58424 |
|---|
| Price | |
|---|
| Order / More Info | MAK10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|