| Edit |   |
|---|
| Antigenic Specificity | MAK3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAK3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAK3. This antibody reacts with human. The MAK3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to NAT12(N-acetyltransferase 12) The peptide sequence was selected from the middle region of NAT12 (NP_001011713). Peptide sequence EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI. |
|---|
| Other Names | MAK3, MGC141884, N(alpha)-acetyltransferase 30, NatC catalytic subunit, N-acetyltransferase MAK3 homolog, N-alpha-acetyltransferase 30, NatC catalytic subunit, putative) |
|---|
| Gene, Accession # | NAA30, Gene ID: 122830, Accession: Q147X3, SwissProt: Q147X3 |
|---|
| Catalog # | NBP1-70631 |
|---|
| Price | |
|---|
| Order / More Info | MAK3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 14702039, 26292663 |
|---|