| Edit |   |
|---|
| Antigenic Specificity | NGL-1/LRRC4C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NGL-1/LRRC4C Antibody from Novus Biologicals is a rabbit polyclonal antibody to NGL-1/LRRC4C. This antibody reacts with human. The NGL-1/LRRC4C Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LRRC4C(leucine rich repeat containing 4C) The peptide sequence was selected from the N terminal of LRRC4C. Peptide sequence LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE. |
|---|
| Other Names | KIAA1580NGL-1NGL1Netrin-G1 ligand, leucine rich repeat containing 4C, leucine-rich repeat-containing protein 4C |
|---|
| Gene, Accession # | LRRC4C, Gene ID: 57689, Accession: Q9HCJ2, SwissProt: Q9HCJ2 |
|---|
| Catalog # | NBP1-59669 |
|---|
| Price | |
|---|
| Order / More Info | NGL-1/LRRC4C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|