| 产品详情 |
| Edit |   |
| Antigenic Specificity | EI2BL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EI2BL Antibody from Novus Biologicals is a rabbit polyclonal antibody to EI2BL. This antibody reacts with human. The EI2BL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EI2BL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRD |
| Other Names | EC 5.3.1.23, M1Pi, Mediator of RhoA-dependent invasion, methylthioribose-1-phosphate isomerase, methylthioribose-1-phosphate isomerase homolog (S. cerevisiae), MGC3207, MRDI, MTNA, MTR-1-P isomerase, S-methyl-5-thioribose-1-phosphate isomerase, Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein, Ypr118w |
| Gene, Accession # | MRI1, Gene ID: 84245 |
| Catalog # | NBP2-47475 |
| Price | |
| Order / More Info | EI2BL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|