| Edit |   |
| Antigenic Specificity | NNT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NNT Antibody from Novus Biologicals is a rabbit polyclonal antibody to NNT. This antibody reacts with human. The NNT Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NNT(nicotinamide nucleotide transhydrogenase) The peptide sequence was selected from the N terminal of NNT. Peptide sequence IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM. |
| Other Names | MGC126502, mitochondrial, nicotinamide nucleotide transhydrogenaseMGC126503, Pyridine nucleotide transhydrogenase |
| Gene, Accession # | NNT, Gene ID: 23530, Accession: Q13423, SwissProt: Q13423 |
| Catalog # | NBP1-59612-20ul |
| Price | |
| Order / More Info | NNT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |