| Edit |   |
|---|
| Antigenic Specificity | NICE-3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NICE-3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NICE-3. This antibody reacts with human. The NICE-3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1ORF43 The peptide sequence was selected from the middle region of C1orf43. Peptide sequence YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ. |
|---|
| Other Names | chromosome 1 open reading frame 43, HCV NS5A-transactivated protein 4 |
|---|
| Gene, Accession # | C1ORF43, Gene ID: 25912 |
|---|
| Catalog # | NBP1-70653-20ul |
|---|
| Price | |
|---|
| Order / More Info | NICE-3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|