| Edit |   |
|---|
| Antigenic Specificity | GPRASP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPRASP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPRASP2. This antibody reacts with human. The GPRASP2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GPRASP2(G protein-coupled receptor associated sorting protein 2) The peptide sequence was selected from the middle region of GPRASP2. Peptide sequence EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ. |
|---|
| Other Names | FLJ35662, FLJ37327, G protein-coupled receptor associated sorting protein 2, GASP2, GASP-2, G-protein coupled receptor-associated sorting protein 2 |
|---|
| Gene, Accession # | GPRASP2, Gene ID: 114928, Accession: Q96D09, SwissProt: Q96D09 |
|---|
| Catalog # | NBP1-56710-20ul |
|---|
| Price | |
|---|
| Order / More Info | GPRASP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|