| Edit |   |
| Antigenic Specificity | GPRASP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GPRASP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPRASP2. This antibody reacts with human. The GPRASP2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GPRASP2(G protein-coupled receptor associated sorting protein 2) The peptide sequence was selected from the middle region of GPRASP2. Peptide sequence EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ. |
| Other Names | FLJ35662, FLJ37327, G protein-coupled receptor associated sorting protein 2, GASP2, GASP-2, G-protein coupled receptor-associated sorting protein 2 |
| Gene, Accession # | GPRASP2, Gene ID: 114928, Accession: Q96D09, SwissProt: Q96D09 |
| Catalog # | NBP1-56710 |
| Price | |
| Order / More Info | GPRASP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |