| Edit |   |
|---|
| Antigenic Specificity | GPR137C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GPR137C Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR137C. This antibody reacts with human. The GPR137C Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GPR137C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP |
|---|
| Other Names | G protein-coupled receptor 137C, G protein-coupled receptor TM7SF1L2, integral membrane protein GPR137C, TM7SF1L2DKFZp762F0713, Transmembrane 7 superfamily member 1-like 2 protein |
|---|
| Gene, Accession # | GPR137C, Gene ID: 283554 |
|---|
| Catalog # | NBP2-58722 |
|---|
| Price | |
|---|
| Order / More Info | GPR137C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|