| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PBX2 |
|---|
| Clone | 2E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PBX2 Antibody (2E9) from Novus Biologicals is a mouse monoclonal antibody to PBX2. This antibody reacts with human. The PBX2 Antibody (2E9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, RNA Inhibition. |
|---|
| Immunogen | PBX2 (NP_002577 354 a.a. - 430 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN |
|---|
| Other Names | G17Homeobox protein PBX2, HOX12homeobox 12, PBX2MHC, pre-B-cell leukemia homeobox 2, pre-B-cell leukemia transcription factor 2, Protein G17 |
|---|
| Gene, Accession # | PBX2, Gene ID: 5089, Accession: NP_002577, SwissProt: NP_002577 |
|---|
| Catalog # | H00005089-M01 |
|---|
| Price | |
|---|
| Order / More Info | PBX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18480829 |
|---|
| 产品资料 |
|
|