| Edit |   |
|---|
| Antigenic Specificity | MIER2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MIER2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIER2. This antibody reacts with human. The MIER2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MIER2(mesoderm induction early response 1, family member 2) The peptide sequence was selected from the middle region of MIER2. Peptide sequence RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE. |
|---|
| Other Names | KIAA1193mesoderm induction early response protein 2, mesoderm induction early response 1, family member 2, Mi-er2 |
|---|
| Gene, Accession # | MIER2, Gene ID: 54531, Accession: Q8N344, SwissProt: Q8N344 |
|---|
| Catalog # | NBP1-56868 |
|---|
| Price | |
|---|
| Order / More Info | MIER2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|