| 产品详情 |
| Edit |   |
| Antigenic Specificity | MIER3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MIER3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIER3. This antibody reacts with human. The MIER3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MIER3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE |
| Other Names | DKFZp686L09111, DKFZp781G1119, DKFZp781I1119, FLJ35954, mesoderm induction early response 1, family member 3, mesoderm induction early response protein 3, mi-er3 |
| Gene, Accession # | MIER3, Gene ID: 166968, Accession: Q7Z3K6, SwissProt: Q7Z3K6 |
| Catalog # | NBP2-38080 |
| Price | |
| Order / More Info | MIER3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|