| Edit |   |
| Antigenic Specificity | FBXO8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXO8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO8. This antibody reacts with human. The FBXO8 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FBXO8(F-box protein 8) The peptide sequence was selected from the middle region of FBXO8. Peptide sequence EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY. |
| Other Names | F-box only protein 8, F-box protein 8, F-box/SEC7 protein FBS, FBSFBX8F-box protein Fbx8 |
| Gene, Accession # | FBXO8, Gene ID: 26269, Accession: Q9NRD0, SwissProt: Q9NRD0 |
| Catalog # | NBP1-55317 |
| Price | |
| Order / More Info | FBXO8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |