| Edit |   |
| Antigenic Specificity | FBXW10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXW10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXW10. This antibody reacts with human. The FBXW10 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human FBXW10The immunogen for this antibody is FBXW10. Peptide sequence RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD. |
| Other Names | F-box and WD repeat domain containing 10, F-box protein, F-box/WD repeat-containing protein 10 |
| Gene, Accession # | FBXW10, Gene ID: 10517 |
| Catalog # | NBP1-79496 |
| Price | |
| Order / More Info | FBXW10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |