| 产品详情 |
| Edit |   |
| Antigenic Specificity | FBXW12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXW12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXW12. This antibody reacts with human. The FBXW12 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FBXW12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPVQEFHFSNLVTLPQMHLAITMDWKKTIKVWNCQDRDALAVLPMPQPCYCMEAYLTKDGPFLMVGDAAGDIYTFTLPGLRDVSKVTAFQY |
| Other Names | F-box and WD repeat domain containing 12, F-box and WD-40 domain-containing protein 12, F-box- and WD40-repeat-containing protein, F-box only protein 35MGC120386, F-box/WD repeat-containing protein 12, Fbw12, FBW12MGC120387, FBXO12FBXO35F-box and WD-40 domain protein 12, MGC120385 |
| Gene, Accession # | FBXW12, Gene ID: 285231, Accession: Q6X9E4, SwissProt: Q6X9E4 |
| Catalog # | NBP2-30769 |
| Price | |
| Order / More Info | FBXW12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|