| Edit |   |
| Antigenic Specificity | FBXW8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXW8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXW8. This antibody reacts with human. The FBXW8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FBXW8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EDGFLNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAVAAAGDLMYLLKA |
| Other Names | F-box and WD repeat domain containing 8, F-box only protein 29F-box/WD repeat-containing protein 8, FBW8F-box and WD-40 domain-containing protein 8, FBX29MGC33534, FBXO29, FBXW6FBW6F-box and WD-40 domain protein 8 |
| Gene, Accession # | FBXW8, Gene ID: 26259, Accession: Q8N3Y1, SwissProt: Q8N3Y1 |
| Catalog # | NBP2-38429 |
| Price | |
| Order / More Info | FBXW8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |