| Edit |   |
| Antigenic Specificity | FBXW9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXW9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXW9. This antibody reacts with human. The FBXW9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human FBXW9The immunogen for this antibody is FBXW9. Peptide sequence PDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSE. |
| Other Names | F-box and WD repeat domain containing 9, F-box and WD-40 domain protein 9, F-box and WD-40 domain-containing protein 9, F-box and WD-40 repeat containing protein 9, specificity factor for SCF ubiquitin ligase |
| Gene, Accession # | FBXW9, Gene ID: 84261, Accession: NP_115677, SwissProt: NP_115677 |
| Catalog # | NBP1-79823 |
| Price | |
| Order / More Info | FBXW9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |